#Eminem

Instagram photos and videos

#eminem#rap#love#hiphop#music#london#50cent#rapper#art#slimshady#twickenham#Eminem#tomhardy#xxxtentacion#artist#marshallmathers#rasalghul#soundcloud#batman#f4f#follow4follow#rappers#freestyle#worldstar#drake#followforfollow#producer#newmusic#trap#rapmusic#hiphopmusic#rnb#beats#hiphopculture#dccomics#liluzivert

Hashtags #Eminem for Instagram

‏‌‌‌‌‏​​​‌‌‌‌‏​​​- حضنك وينتهي ألف شوقْ وشُعور~"💞
..
.
.اسوي منشن انشر حسابك .
#Legend_Designs |#Siyahinci
.
. #lōst
#comments.
.
.@__97
#fashion |#eminem
.
.
. #SenAnlatKaradeniz |#explore
#comments. .#lōst , #٨2, ,#اكسبلور_فولو ,#Explore ,💔 .
.#group_art .#new ,#37 ,#666 ,#ax_6_g#rellx .#group_max .#kara_sevda .#60s .
.
.
.


0

Fødselsdagsgave fra min mand - billetter til Eminem koncert i Hannover. Gud, en fornøjelse 🙏 #slimshady #eminemhannover2018 #eminem


0

"Underground" [Verse 1]
I hate when people mistake me or take me as mainstream,
Nothing has paid me but ain't it crazy I wrote more raps then shady,
I used to rap about ladies, cars, bars and sauce like gravy,
But I don't need you hoes with your loose holes I got a beauty to date me,

I'm realer then an ass that has grown naturally,
when I'm shooting bullets I have pin point accuracy,
If I wanna get real no ones rapping faster then me,
I'll leave your fan base asking "how fast can he be", I'm not a clueless cupid I'm mr stupid I don't shoot shit,
But if ya wanna feel lucid just listen to my new shit,
And maybe you can use it to make your own music,
Its like cheating on a test its stupid cuz the eyes are on the new kid,

He is I and I am him calling in dre like I'm a 1990's slim,
Imma get under your skin and then the tension begins,
Its like no matter how much I bid I can't sell off my sins,
I got a heart made out of tin I don't let most people in,

The people that once knew me can look right through me,
I may be the mister loony but I'm not a fucking goonie,
Oh shit now a movie company wanna fucking sue me,
These simple minds don't move me this ain't a cinematic movie,

I don't shoot an uzi but the talent that I'm oozing might lead ya to shoot me,
With an uzi but the bullets don't go through me whatcha doing,
If this a movie this shit based off real events because you don't know my intent,
Don't believe the internet I be caught in the interwebs don't believe me I'll leave ya caught in an intersection,


#love #producer #rapper #comingsoon #chesterbennington #composer #rap #hiphop #unsigned #undergroundrap #undergroundhiphop #underrated #artist #lyrics #songwriter #broken #sad #bullied #hated #xxxtentacion #eazye #eminem #album
#hardcorerap


0


1

Omg!! I'm so loving this! Love tht he's hvn sum fun!! Soooo much freakin love this!! ❤️❤️❤️❤️ #tomhardy #hesthebest
Regrann from @tomhardyvariations - #Repost @carolinetonkinson
・・・
Special guest 50 cent at Eminem Revival tour! @50cent @eminem @tomhardy
.
.
#eminem #twickenham #50cent #indaclub #tomhardy #revival - #regrann


0

В 2002 мне было 16. Тогда мне родители все время повторяли, что нужно хорошо учиться в школе, в университете, чтоб потом иметь возможность идти к своим мечтам и целям. Но тогда я не мечтала об этом концерте. Это все было на другой планете, даже не думала, что можно взять билет, прилететь, через 15 лет, представляете?! Я столько раз посмотрела фильм 8 миля тогда в школе, что мне стыдно признаться, но я знала каждое слово в этой песне. Эминем крут, у меня были мурашки от каждого слова и ком в горле на самых любимых треках. Теперь буду ждать новый его концерт где-нибудь в другой точке планеты. Не переключайте)

#эминем #лондон #великобритания #london #eminem #twickenham


0

I had such a good run through today with my MPDV routine I thought I would have some fun combining snippets from different parts of both my MPDV and Sexy's Back routines into one sequence, rather than drilling the exact same things over and over. That way I'm still practicing stuff I should, but it doesn't feel like a chore #compprep #training #butstillhavefun #complife #dontbetooserious #eminem #d12 #myband #makesmegiggleeverytime #staticpole #splits #tumbles #symfamily #sympolelife #symmetry #lifeisallaboutbalance


0

Gambino | 📷 @joshuamellin


1

Will the real slim shady please stand up? #eminem #london #2018 #eminem #revivaltour


0

Your in the front seat, it's your life, take control.
Only 1.5h left to help us make a change in Detroit, you make a difference man, you matter. Check out the link in our bio to get involved whilst giving yourself a brand new gift, you don't wanna miss out on this one before it's gone. Enjoy your weekend. #eminem #quote #detroit #charity #drugballad


1

Well what an adventurous 24 hours that was! @rachyroodle @katealia .
.
#eminem #london #makingmemories #livingfortheweekend


0

CD Eminem - Revival (Import) .
.
New (Segel)
CD Original Import EU
Kemasan: Jewel Case
Release date: 15 Des 2017
Label: Aftermath Ent, Shady Records, Interscope Records
Category: Audio CD
Harga: 245rb
.
.
For Order:
Whatsapp: 082220355563
DM
.
.
https://shopee.co.id/mesti.ori
https://tokopedia/mestiori


1

16 years ago today, former Soul Intent member @Eminem released Cleaning Out My Closer as the 2nd single off his 4th album The Eminem Show under his own label @ShadyRecords in conjunction with Aftermath Entertainment alongside @Interscope & Web Entertainment. Produced with Jeff Bass, this is a much more serious song in contrast to the album’s previous single “Without Me” being performed in his infamous alter ego Slim Shady. The 1st verse sees Em dealing with the criticism & activism against his lyrics along with how those people do not understand his background & personality. The 2nd verse then moves onto how his father abandoned him & his mother Debbie when Eminem was a baby while promising his own daughter Hailie he‘ll never do the same thing. The final verse is a SAVAGE diss towards Debbie, but Em would eventually apologize to her in 2013 on the track "Headlights" off his 8th album The Marshall Mathers LP 2. Despite the fact that Eminem himself has stated that he now cringes when he hears this song on the radio & that he stopped performing it at live shows, I personally think this has to be in the Top 10 Best Eminem Songs
#Eminem #SoulIntent #Outsidaz #D12 #BadMeetsƎvil #CleaningOutMyCloset #TheEminemShow #ShadyRecords #AftermathEntertainment #InterscopeRecords #WebEntertainment #GoliathManagement #RIPBugz #RIPProof #TeamShady


2

Nowadays everybody wanna talk like they got something to say
But nothing comes out when they move their lips
Just a bunch of gibberish
And motherfuckers act like they forgot about Dre - Eminem #eminem #dre


0

"he's inherited mine, which is fine, ain't like either of us mind
We still have soldiers that's on the front line
Who's willin' to die for us as soon as we give the orders
Never to extort us, strictly to show they support us
And maybe shout 'em out in a rap or up in the chorus
To show 'em we love 'em back and let them know how important
It is to have Runyon Avenue soldiers up in our corners
Their loyalty to us is worth more than any award is
But I ain't tryin' to have none of my people hurt or murdered
It ain't worth it, I can't think of a perfecter way to word it
Than to just say that I love y'all too much to see the verdict
I'll walk away from it all 'fore I let it go any further
But don't get it twisted, it's not a plea that I'm coppin'
I'm just willing to be the bigger man if y'all can quit poppin'
Off at your jaws, well, then I can, ‘cause frankly I'm sick of talkin'
I'm not goin' to let someone else's coffin rest on my conscience" #eminem #liketoysoldiers #rap


0

Come on B-rab lets split a cab😉🙈😃✌🏽
Repost @hiphopforhealing
・・・
„Penis Rice” huh @eminem ?„You can not split my cabbage!”🙈hmm...cause it’s B-Rabbit’s?c’mon Rabbit please lettuce split your cabbage👀🐐🤣🤣🤣✌🏽🇬🇧👊🏽 #revivalplate #revivaltour #eminem #marshallmathers #london #londonfood #food #pizza #frenchfries #cabbage #hummus #food #foodgasm #foodporn #food #penisrice #hiphop #eminemnews / ☮️#mariesunpeace #peacethesmartist #frederikkemarie #danishgirl #denmark 🇩🇰✌🏽 #Repost @eminem


0

My ass feels numb. #eminem #エミネム


0

@Eminem #London, UK, #Twickenham Stadium, 15.07.2018 #RevivalTour #eminem


0

When Ed Sheeran turns up to support Eminem 🙃 #eminem #edsheeran #twickenham #revivaltour #london


0

#eminem & #50cent onstage together. What a dream. #twickenham #london #rapgod #eminemtour @eminem @50cent


0

@Eminem - #LoseYourself (#London, UK, #Twickenham Stadium, 15.07.2018) #RevivalTour #eminem


0

Tak ďalší sen zo zoznamu splnený... Včerajší koncert prekonal aj moje vybičované očakávania... Vidieť v jeden večer na pódiu Eminema, 50 Centa, Eda Sheerana, Skylar Grey, Alchemista, Royce 5'9 a pre mňa neočakávane aj B Reala zo Cypress Hill tak to je moc... A to všetko podtrhnuté neskutočnou živou kapelou vrátane čela, huslí, perkusí a ešte so skvelou veľkoplošnou projekciou... Hodnotím 10/10 #eminem #london #twickenham #rapgod #marshallmathers #dreamcomestrue✨


0

Tommy fan pic.
.
Repost @privatefoto
“just met @tomhardy during @eminem’s set in #london tonight!
perfect moment for a #selfie right ?
can’t wait to see his new movie #venommovie
#tomhardy
#tourlife
#prophetsofrage
#brealtv
#dope
#goodtimes
#actor
#fun
.
Eminem/50 Cent Concert | Twickenham Stadium, London | July 15, 2018
. . .
#50cent #eminem #concert #beard #beardporn #tattoos #tattooporn #perfection #gorgeous #liferuiner #fanpic #scissafingas


0

Tommy fan pic, with those scissa fingas! ✌🏻
.
Repost @jackieorch
“Bitch u best believe I swerved so fast and hurdled three children when Danny told me Tom Hardy was behind me to get this photo and as a result I look like a electrocuted chicken but the point is that I MET TOM HARDY 😭😍😫
.
Eminem/50 Cent Concert | Twickenham Stadium, London | July 15, 2018
. . .
#tomhardy #50cent #eminem #concert #beard #beardporn #tattoos #tattooporn #perfection #gorgeous #liferuiner #fanpic #scissafingas


0

Tommy fan pic.
.
Repost @tom_hardys_pimpstress
Steven Douglas Twitter
"One of the finest actors of my generation. And seemingly a very nice guy to boot. Tom Hardy!"
.
Eminem/50 Cent Concert | Twickenham Stadium, London | July 15, 2018
. . .
#tomhardy #50cent #eminem #concert #beard #beardporn #tattoos #tattooporn #perfection #gorgeous #liferuiner #fanpic


3

Tommy fan pic.
.
Repost @beccibreen
“Literally shaking. How have we just met Tom Hardy. Best day of my life. #tomhardy #love #obsessed #starstruck #palmsaresweatykneesweakarmsareheavy
.
Eminem/50 Cent Concert | Twickenham Stadium, London | July 15, 2018
. . .
#tomhardy #50cent #eminem #concert #beard #beardporn #tattoos #tattooporn #perfection #gorgeous #liferuiner #fanpic


15