#FitToFight

Instagram photos and videos

#fittofight#fitness#martialarts#selfdefense#mma#FitToFight#bodybuilding#muaythai#nutrition#airforce#kickboxing#npc#exercise#kravmaga#training#crossfit#bjj#combatives#veteran#revolution#trainlikeanathlete#boxing#functionalfitness#usaf#wod#greatness#FreeDeeOmFitness#beauty#bikini#model#SunLightsDirection

Hashtags #FitToFight for Instagram

👀 Omg thought I overslept & missed Power Circuit 🤣!!!! Rise up, bless up, Zeal up & let’s get ready to power up to a gr8ter you ❤️💛💚!! 📣TODAY'S CLASS SCHEDULE 📣
8:30am: Power Circuit at LA Fitness (check your LA Fitness app for my sub updates daily) (30min partnership trainings are available today, click on this link to book your slot today:https://www.schedulicity.com/scheduling/FFPDAQ)
🚨 🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨
Click on this link: https://www.zurvita.com/zealotfitness/en/us/contact/ and type “FREE CONSULT/CORPORATE FITNESS ”for more information about my partnership and corporate fitness training program!!!!!!! FreeDee🌎M Fitness & Wellness
#FreeDeeOmFitness #MarineQweenz #ZealotFitness #SunLightsDirection #fittofight #PTSD #USMC #veteran #martialarts #bodybuilding #npc #natural #bikini #fitness #athlete #model #StrongbyZumba #Zumba #vegetarian #vegan #locs #divine #goddess #nutrition #wealth #wellness #beauty #revolution #greatness


0

Guerrera’s Boxing, Beer, and Body Positivity was a huge success last night. Join us every Friday at 6:30pm for hittin’ shit, beer, and community. Mark your calendars for a special Boxing and Body Positivity event benefitting @rockrecovery, July 20 at 6:45 pm! #Guerrera #FitToFight #StayNFlux #boxing #dc


1

SWEAT IT OUT SATURDAY! This week was pretty long lol. Don’t let the weekend ruin the hard work you put in during the week, and make bad eating choices. Get up get out and do something! #fittofight #lifestyle #lifequotes #motivationalquotes #fitnessaddict #fitnessmotivation #getsome #policefitnessnutrition #tactifit #leanbody #changeyourlife #changeyourmind #changeyourbody


0

Today I will be strong 💪. Stronger than yesterday. #bestrong ..
Today I fight. 👊 Fight hard for those go can’t fight anymore #dad #fittofight ..
Every single day is a new day ☀️. You get out of it what you put into it. Simply put...give it your best! ..
#advocarestrong
#sparkmeup
#feeltheburn
#myweigh2go


1

Fellow #teamfieldcraft tribe member @addison_teamfieldcraft running into this weekend like, “Ready or not here I come; I’m going to find you!” Our brother executed a great run featuring solid lifts, accelerating and decelerating skills while laying rounds on target during an anaerobic course of fire. How conditioned is your work capacity? #survivalfit
•
#trainlikeyoufight #fittofight #trainlikeanathlete #dowork #noweakshit #boutthatlife #functionaltraining #functionalfitness #fieldcraftsurvival #tribelife #tacticalathlete


10

@fireteamwhiskeymilitaryfitness taught me how to control my sugar and carb cravings! Now instead of energy drinks loaded in sugar and chemicals, I drink the Keto Joe shake! With healthy fats, MCT’s, caffeine and protein! Check them out at www.fireteamwhiskey.com 👍💪🇺🇸 #keto #hiit #militaryfitness #army #navy #airforce #marines #coastguard #fittofight #alwaysready #warriorspirit #firstresponders #firefighter #leos #mct #healthyfats


2

Come to the first ever @hillafbwarriorfit #CrossFitHill Foundations Clinic on 30 June from 0800-1200. It is free! Scheduled classes will begin July or August! .
.
.
#crossfit #box #crossfitlife #crossfitfamily #crossfitcoach #nutrition #mindset #wod #crossfitfoundations #freeworkout #utahfit #airforcestrong #fittofight


0

If you’re in #sandiego come get your workout on with us tomorrow morning. We’ll be setting up an agility course on the beach by the firehouse and lifeguard tower in Pacific Beach
•
$25 to sweat it out doing a workout that simulates different tasks that firefighters are often called upon to do. All proceeds go to improvements for #firestation21
•
Visit pbtowncouncil.org/firefighterfit, the link in profile or DM for details. Workout is going down at 0800hrs. See you there!
#fittofight #fittofightfire #fundraiser #functionalfitness #functionaltraining #tacticalathlete #firefighterfitness @pacific.beach


2

My 3rd little run of the week, trying to stay fit & positive#worksforme#running#fitness#fittofight#fuckcancer


0

No gym membership? No excuses! Always something you can do.
21-15-9
DU
Air Squats
Push-ups
With 20lbs weight vest
Head over to @supportmilitarymuscle and use code Nico10 to get 10% off. Each shirt you buy @supportmilitarymuscle will donate one to a homeless veteran or deployed military member.
#HWPO #militarymuscle #supportmilitarymuscle #iammilitarymuscle #faMM #faMMily #usmc #army #navy #coastguard #usaf #military #veterans #wedothework #duespaid
#crossfit #crossfitlife #crossfitaddiction#crossfitconnection #functionalfitness
#onepercentmore #community #fittofight #fitness #lifestyle #squatlife #legday


2

🌍 Happi FreeDeeOm FREEstyle Friday 🌍
When your sis⭐️ is just as EXTRAordinary & full of Zeal like you!!!!!! #GetFree
Who's ready to experience "Fitness After Dark"? Yes, you can be sexy & tighten that body up at the same dang time 👑’s!!!! Let’s get ready to let our hair down & SHAPE that money maker into something gr8ter🤣👀 Standby for the launch date!!!! 📣TODAY'S CLASS SCHEDULE 📣
5:45: Subbing Zumba®️️ at LA Fitness (check your LA Fitness app for my sub updates daily) (30min partnership trainings are available today, click on this link to book your slot today:https://www.schedulicity.com/scheduling/FFPDAQ)
FOR INSTRUCTIONAL PURPOSE ONLY NO COPYRIGHT INFRINGEMENT INTENDED 🚨 🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨
Click on this link: https://www.zurvita.com/zealotfitness/en/us/contact/ and type “FREE CONSULT/CORPORATE FITNESS ”for more information about my partnership and corporate fitness training program!!!!!!! FreeDee🌎M Fitness & Wellness
#FreeDeeOmFitness #MarineQweenz #ZealotFitness #SunLightsDirection #fittofight #PTSD #USMC #veteran #martialarts #bodybuilding #npc #natural #bikini #fitness #athlete #model #StrongbyZumba #Zumba #vegetarian #vegan #locs #divine #goddess #nutrition #wealth #wellness #beauty #revolution #greatness


1

Our torturer today at @urbantacticsllc. Brad Burk from Burk Coaching has been putting the team at Urban Tactics through a vigorous workout program. He will be offering coaching out of our gym in Flint, MI in order to help you meet your fitness goals! His bio and a way to contact him directly will be posted on our website soon. Link to website is in bio!
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
#workout #kravmaga #selfdefense #fittofight #workoutmotivation #kettlebell #fitness #sweatitout #crossfit #onnit #lift #hardtokill


0

🌍 Happi FreeDeeOm Friday 🌍
This is the day to live, live life more abudantly now, BE determined on purpose & flex your Zeal power 👑’s!!!! #GetFree #40

Gr8 job this morning partners that's how your PUSH through to a gr8ter you!!!! Hydrate, refuel, stretch & let's end this FreeDeeOm Friday strong together ❤️💛💚 📣TODAY'S CLASS SCHEDULE 📣
5:45: Subbing Zumba®️️ at LA Fitness (check your LA Fitness app for my sub updates daily) (30min partnership trainings are available today, click on this link to book your slot today:https://www.schedulicity.com/scheduling/FFPDAQ)
🚨 🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨
Click on this link: https://www.zurvita.com/zealotfitness/en/us/contact/ and type “FREE CONSULT/CORPORATE FITNESS ”for more information about my partnership and corporate fitness training program!!!!!!! FreeDee🌎M Fitness & Wellness
#FreeDeeOmFitness #ZealotFitness #SunLightsDirection #fittofight #PTSD #USMC #veteran #martialarts #bodybuilding #npc #natural #bikini #fitness #athlete #model #StrongbyZumba #Zumba #vegetarian #vegan #locs #divine #goddess #nutrition #wealth #wellness #beauty #revolution #greatness


0

“Our mission at Aperture Fight Focused is to create openings, to shine light, on those that are seeking truth, with no preference to source or lineage, and in some cases, to shine that same light on those trying to keep others in the dark.”
.
.
Represent the mission. Shirts are available at ApertureFightFocused.com
.
.
#aperturefightfocused #ryanhoover #jaredwihongi #fittofight #pekititirsiatacticalassociation #funkertactical


6

Don't just read the picture. Read the caption by @ryanmichler. Don't be a victim. Don't hold grudges over petty shit. Be a better man than that. .
.
#SelfDefense #MuayThai #Bjj #Judo #EndTheFight #DefendProtectControl #Shootboxing #FitToFight #Wrestling #JiuJitsu #KnifeDefense #GunDefense #KravMaga #PersonalDefense #Donuts #KneeOnBelly #KnightJiuJitsu #BloodChoke #RevGear #BeTheAlpha #FindYourAlpha #DontBeAVictim #NoExcuses

#Repost from @ryanmichler with @regram.app ... So many men who love to play the “victim card.” They believe that everybody and everything is stacked against and out to get to them. In reality, we know that’s not true. That’s not to say that some negative situations won’t happen. Of course, they will. People will screw you and, frankly, there are evil but the overwhelming majority of the time, it’s not that anyone is out to get us but that we become our own worst enemy. We have become a victim of ourselves. We are not a victim of other people. We are not a victim of our circumstances. That may have been true when we were children and had no control or say over our lives. Now that we’re adults who make our own decisions, there’s no excuse to play the “victim card.”
.
Check the link in our bio for...


0

Boulder shoulder Friday! 155 lb press kicked my butt but maxed it out. Added in a sitting shoulder press to work on the core at the same time. Will be adding that to my workout. Taking it old school with the random pandora playlist. @1stphorm @underarmour #freedom #iam1stphorm #bodybuilding #gymmotivation #core #bouldershoulders #shoulderpress #fitness #airforce #fittofight #militarymuscle #pr #heavyweight #headphonesonworldoff #gymmusic #playlist #fit #gains


0

แค่นี้ื พอแล้วไหม เหนื่อย😅😅 #TAEKWONDO ครูเบลล์🥋🇹🇭🇰🇷 #fittofight #fitforlife


0

Last night's Killing It class was awesome!!! 3 rounds, 6 stations, 1 minute per station, 18 minutes of pure joy!
.
.
#SelfDefense #MuayThai #Bjj #Judo #EndTheFight #DefendProtectControl #Shootboxing #FitToFight #Wrestling #JiuJitsu #KnifeDefense #GunDefense #KravMaga #PersonalDefense #KneeOnBelly #KnightJiuJitsu #BloodChoke #KillingIt #RevGear


0

A good 3 mike hike took us about 45 minutes this morning. Great weather, damn good friends, and loving the Freedom Friday! #moguard #thegoodlife #livetoserve #battlebuddies4life💪🏼🇺🇸 #soldieringup #ruckit #fittofight


0

Quick two miles in this morning before the busy day begins.
Keep pushing everyone!
#workingforcolin #poweredbyketones
#workingforhugh #ketones #pruvit #4thalarmapparel #7FIT #FITFAM #fittofightfire #fittofight #555fitness


0

Train endlessly for that moment. #FitToFight #NeverBackDown


0

I’m Strong because i’ve been weak,
I’m Fearless because i’ve been afraid,
I’m Wise because i’ve been foolish.. Just learn from past n grow.✨
.
.
.
#fittofight#workoutmotivation#lawofattraction#instagood#picoftheday#themindfulapproach#in#boxing#mode#love#challenges#delhi#posture#fightclub#instapic#muscles#flex#on#them


4

Beautiful morning in our states capital to get our Ruck on! Let’s go boys! #moguard #thegoodlife #livetoserve #battlebuddies4life💪🏼🇺🇸 #soldieringup #fittofight #ruckit


0

Job’s done for the morning so I had to get in a photo op in front of the official weigh-in back drop. #ufc #ufcsingapore #fashionista #styleblogger #fashionblogger #gucci #stylegram #lovemyjob #bestjobever #passyourphysical #fittofight


5

I have been having my son work out with me got to have him ready for any thing and everything he gonna be a stud at every sport fr fr.. I told him instead of getting ur ur ass whooped with a belt u have to whoop some ass for the belt lol... #behumble #wefighten #handsfordays #muhammedali #supersaiyan #levelingup #dbz #FittoFight #fightlife #MMA #bjj #muaythai #Boxing #turndownnofades #aau #basketball #football #baseball #mlb #nfl #nba #belts #teamafromonkey #teamapex #supersaiyanjr #minisaiyan #gohan #gotenks


0

Still got rounds to knock out on the heavy bag... #PutInTheWork #BackOnMyGrind #FitToFight #TheWayOfTheWarrior


0

Ok last post from yesterday’s session featuring 3 other exercises. Slo-mo 😁
✅TRX Mountain Sliders
✅Offset KB hold + 1arm tire flips
✅Running sliders
✅and of course more hulk elbow smashes...I played with the dummy for 15mins, so I wanted to share more 🤷‍♂️
•
#fieldcraftsurvivalfit #teamfieldcraft #exercise #fittofight #fitforlife #survivalfit #atlasathletic #noweakshit #trainlikeanathlete #dowork #grindout #getafterit #iamatlas


12

Whewwww what a challenging day but guess what👀 I got those gains to gr8ter in spite of how I felt💪🏾💃🏾!!! When you’re committed, you show up no matter what!!!!!! #GetFree #ImInItToWinIt
PUSH thru it all 👑’s & end with those vibes high in gratitude tonight no matter what it looks like right now❤️💛💚!!! Trust me on this!!!! Gr8 night🙏🏾 📣 TOMORROW’S CLASS SCHEDULE 📣
5:45PM: Zumba®️️ (30min partnership trainings are available today, click on this link to book your slot today:https://www.schedulicity.com/scheduling/FFPDAQ)
FOR INSTRUCTIONAL PURPOSE ONLY NO COPYRIGHT INFRINGEMENT INTENDED 🚨 🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨
Click on this link: https://www.zurvita.com/zealotfitness/en/us/contact/ and type “FREE CONSULT/CORPORATE FITNESS ”for more information about my partnership and corporate fitness training program!!!!!!! FreeDee🌎M Fitness & Wellness
#FreeDeeOmFitness #ZealotFitness #SunLightsDirection #fittofight #PTSD #USMC #veteran #martialarts #bodybuilding #npc #natural #bikini #fitness #athlete #model #StrongbyZumba #Zumba #vegetarian #vegan #locs #divine #goddess #nutrition #wealth #wellness #beauty #revolution #greatness


0

Another day at the grind. Now I’m headed home to spar with the dreaded Dublin Whitebeard. #nationalselfieday #bjj #muaythai #mma #martialarts #healthylifestyle #graciebarra #jiujitsu #sober #healthyliving #cleanliving #fitnessjourney #fitnessmotivation #fittofight #kickboxing


4

Going keto, started my day off with a bulletproof coconut oil coffee, then went for a 25 mile bike ride, 30 min strength training at the gym. Now time to try this keto sloppy-joe meal that I came up with. #keto #fitness #weddingfitness #fittofight #motivation


5

Every 98 seconds, an American is sexually assaulted.
And every 8 minutes, that victim is a child.
This is preventable in many cases! Learn how to protect yourself and those you love! Come out to our classes and learn situational awareness, conflict de-escalation, use of force, and the laws governing self-defense. Refuse to be a soft target! Please like and share our page to your friends and family! If you have been a victim of domestic violence, you don't have to spend the rest of your life in fear. Contact us for a free training to help you regain control of your life.
@urbantacticsllc .
.
.
.
.
.
.
.
.
.
.
.
.
.
#selfdefense #uscca #refusetobeavictim #metoo #glock #kravmaga #mma #hardtokill #training #fitness #firearmstraining #firearmsinstructor #pewpew #fittofight


2

That face you make when you’re about to hit really damn hard. .
.
.
.
#wftx #wichitafalls #selfdefense #kravmaga #fittofight #fittofightrepublic


1

#HeavyBag Routine:
10rds - 20mins (2min rds:20s rest)
•
1️⃣Warmup. Get the heavy bag swinging, then start moving around it, but don’t throw any punches. Step towards and away from the bag as it moves, as well as left and right as the bag swings to the side. Visualize the bag as your opponent.
2️⃣jabs work, both singles and doubles, while making sure to continue moving your feet around the bag.
3️⃣1-2 jab combinations while gauging and practicing your punch range.
4️⃣2 -3 punch combos with your main focus being delivering the punches with speed.
5️⃣Throw consecutive 1-2 punch combos in 10 second intervals, followed by 10 seconds of rest. Keep moving on the balls of your feet during the rest interval.
6️⃣Freestyle, just move and punch using combinations, and varying your punch levels, while maintaining good hand speed.
7️⃣ 2-3 punch combinations for speed (Repeat of Round 4).
8️⃣Freestyle Round (Repeat of Round 6).
9️⃣1-2 punch combination intervals (Repeat of Round 5).
1️⃣0️⃣Freestyle. Put everything together in the last round. Give it all you’ve got and work as hard as you can. Throw 1-2 and 2-3 combinations, varying your punch levels, and delivering with good footwork and speed.
•
THE FOUNDATION WORKOUT PROGRAM 🇺🇸
•
#fieldcraftsurvivalfit #exercise #fieldcratsurvival #fittofight #survivalfit #heavybagworkout #sofprep #trainlikeanathlete #thinlinefitness #tacticalathlete #fitnessjourney #dowork #noweakshit #getafterit


2


2

This quote came from a broader discussion. The industry is thick with a cacophony of voices touting cliches that almost encourage and definitely glorify, violence. This needs to stop. Failure is most definitely an option, and telling people otherwise is intellectually dishonest and dangerous.

Training matters. So does honesty. #training #honesty #fittofight #getit #aperturefightfocused


18

In life and sports, run with those faster than you if you ever want to improve! THESE TWO ARE FASTER THAN ME! 💨🇺🇸
#fitness #fit #running #goodstuff #fittofight #goodtogo #nationalguard #minnesota #airnationalguard #aimhigh #airforce #run #team #exercise #wingmen #processofgrowth #sgtsprick


1

#tbt The first time I ever stopped on stage. Never would have thought that I would still be competing 5 years and 9 shows later. Thankfully I get better with each year that passes. So thankful to be able to do this as a hobby. #npc #npcusa #gymlife #ifbb #igfit #igfitness #militarymuscle #military #airforce #usaf #securityforces #sf #cop #lawenforcement #le #fittofight #monster #bodybuilding #crossfit #iifym #ifitfitsyourmacros #flexibledieting #isymfs #picoftheday #exercise #eatbiggetbig #massmonster


1

Fail to prepare and you’re preparing to fail. When called upon, skills and training won’t manifest out of thin air. Get out and train.
@tajamulislam_
#kcwarrior #kashmircombatives #combattraining #fittofight #mma #kickboxing #muaythai #boxing #fighting #martialarts #selfprotection #trainhard #fightharder


5

Our hotel had a great gym for our “good morning Warrior workout” or as SSG Immler and I call it Freedom to do what we want! Freedom, weights, and protein shakes. What more do you want?! #moguard #thegoodlife #livetoserve #battlebuddies4life💪🏼🇺🇸 #fittofight #soldieringup #nodaysoff


1

This is the day to wake up, live, live life more abundantly & break your fast with complete nutrition💪🏾 Did you wake up hungry? Did you skip breakfast? How did you break your fast?
Join my partnership program today & learn how to break your fast to get results 👑’s!!!!! Belly full, zealed & ready to help someone reignite heir fire within to win on purpose ❤️💛💚!!! 📣 TODAY’S CLASS SCHEDULE 📣
5:00pm: Zumba®️️ at (Associates only) (30min partnership trainings are available today, click on this link to book your slot today:https://www.schedulicity.com/scheduling/FFPDAQ)
FOR INSTRUCTIONAL PURPOSE ONLY NO COPYRIGHT INFRINGEMENT INTENDED 🚨 🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨🚨
Click on this link: https://www.zurvita.com/zealotfitness/en/us/contact/ and type “FREE CONSULT/CORPORATE FITNESS ”for more information about my partnership and corporate fitness training program!!!!!!! FreeDee🌎M Fitness & Wellness
#FreeDeeOmFitness #MarineQweenz #ZealotFitness #SunLightsDirection #fittofight #PTSD #USMC #veteran #martialarts #bodybuilding #npc #natural #bikini #fitness #athlete #model #StrongbyZumba #Zumba #vegetarian #vegan #locs #divine #goddess #nutrition #wealth #wellness #beauty #revolution #greatness


0

📿She is an old soul that believes in chivalry, romance and love.🐾❤️
#wildspirit
#oldsoul
#fittofight 💪
#cafeontherocks


14

#throwbackThursday Here we see a member of the 3rd County of London Yeomanry firing the Thompson sub-machine gun in 1940. We wish we could fire from the hip nowadays! 📷 credit: @nam_london .
.
.
#londonslightcavalry #CSQN #KSY #thesharpshooters #BritishArmy #royalyeomanry #armyreserve #desertrats #lightcav #cavalry #weekendwarrior #paidtotrain #royalarmouredcorps #fittofight #thisisbelonging #findwhereyoubelong #recon #reconnaissance #london #southlondon #croydon #surrey #sussex #thompson #Chicagotypewriter #tommygun .
.
Join the Royal Yeomanry on the last Wednesday of every month at 1945hrs, at The Army Resrve Centre, Mitcham Road, Croydon, CR0 3RU for their Army Reserve open evening!


0

@fireteamwhiskeymilitaryfitness is no joke. 22lbs down in my first 30 days!! It’s not a gimmick, trendy plan or rocket science! It’s simple, but not easy! If you are a current or former military or first responder personnel you need to check it out at www.fireteamwhiskey.com #keto #hiit #militaryfitness #army #navy #airforce #marines #coastguard #fittofight #alwaysready #warriorspirit #firstresponders #firefighter #leos


0

Once a bell swinger.... always a bell swinger. 💪🏼 Thanks @empoweredstrength for the kettlebell addiction. Missing you guys in San Antonio! #empoweredstrength #adventuresofmissb #usaf #unitedstatesairforce #fittofight #bendoregon


5

Your @battlebuddyusa works for America here, beside @blackriflecoffee 💚🖤Always Ready! 🇺🇸


1

Morning look vs evening look. Wondering which is better. #kravmaga #fittofight #isthisthelookforme #lookingglam #lookingmarvelous


2

You're Only One Workout Away From A Good Mood 💪🏾💜💪🏾 #FitToFight #Fitness #CheetahsStayFit #NeedAbs #FitMom #SummerTimeFine 🌞


3

Here’s a few exercises from this morning’s 5am session.
✅3 Deadbug variations:
1️⃣Alternating arms/legs
2️⃣Alternating legs+Plate Press
3️⃣Alternating legs+Plate hold
✅BB Shoulder Press w/alternating grip -seated
✅Bent-over BB Row w/alternating grip
•
✳️Although when I perform the exercise it looks more like a bug that was freshly sprayed, so I’m in that twitching stage😂
The Deadbug is an exercise that’s featured in The Foundation Workout Program by @fieldcraftsurvivalfit •
✳️2 good deadbug benefits:
1️⃣teaches the user to not only isolate movement at the hips and shoulders. But allows you to actively engage your ROM in those joints.
2️⃣Spinal and transversus abdominis stabilization (core engagement)
•
There are other progressive variations of the exercise that I will record and share in the near future.
•
@atlas_athletic tee 🇺🇸 (code jt_trail)
@fieldcraftsurvival cap 🇺🇸 (code trailhead)
#teamfieldcraft #survivalfit #fieldcraftsurvival #exercise #fieldcraftsurvivalfit #fitforlife #functionalfitness #fitspo #fitspiration #fittofight #trainlikeanathlete #athleticoveraesthetic


1

We talk a lot about throwing ladders, but what about overhead squatting them 😂😂😂 some vids from our workout the other day. Guest appearance by LT 😂👊🏽 #firefighter #firefighterfitness #FitToFight #NextRung @next_rung #crossfit #crossfitgirls #CrossfitDwala #DwalaRangers #GirlsWithMuscle #GearWorkout #LittleAndLethal #GymRat #Weightlifting #Cleans #OHS #Ladders #LiftLife #GirlsThatLift #TodosADios @555fitness @crossfit


16