#healthyfats

Instagram photos and videos

#healthyfats#keto#healthyfood#lowcarb#lchf#healthylifestyle#weightlossjourney#nutrition#glutenfree#paleo#fitness#ketofood#plantbased#ketogenic#avocado#ketodiet#weightloss#eatclean#grainfree#ketofam#lowcarbhighfat#ketosis#sugarfree#lowcarbdiet#diet#eatrealfood#healthy#ketolife#health#protein#wellness#nuts

Hashtags #healthyfats for Instagram

@fireteamwhiskeymilitaryfitness taught me how to control my sugar and carb cravings! Now instead of energy drinks loaded in sugar and chemicals, I drink the Keto Joe shake! With healthy fats, MCT’s, caffeine and protein! Check them out at www.fireteamwhiskey.com 👍💪🇺🇸 #keto #hiit #militaryfitness #army #navy #airforce #marines #coastguard #fittofight #alwaysready #warriorspirit #firstresponders #firefighter #leos #mct #healthyfats


0

A little healthy snack 🥜

Have a Healthy Day 🍊
Sharon
Http/rod-sharonlegrande.goherbalife.com
#nuts #healthyfats #snacks #herbaltea #metabolism #wellness #fitness #letsgethealthy #allaboutbalance #weightlossjourney #nutrition #weightlossover50


0

Buffalo chicken dip lettuce wraps with lettuce from the garden 🥗☺️ I just got Trader Joe’s #everythingbutthebagel seasoning blend for the FIRST time this week...show of hands, who else after finally trying it for the first time said to themselves...”what else can I sprinkle this stuff on?!?!!” 🙋🏻‍♀️The answer is...everything 😂🤣😂




#keto #ketofood #healthyfats #foodtracking #ketolettucewraps #gardenfresh #lchf #lowcarb #lowcarblifestyle #sugarfree #ketosis #tasty #ketokaiser


1

One of the easiest ways to pack veggies into a meal is with a green shakshuka! It's super customizable and works with pretty much whatever you have on hand.

Sautee some veg (today I used cabbage, brussels, onions, garlic, and kale in avocado oil), add some spices (I used cumin, s&p), crack a few pastured eggs on top, pop in the oven for a few minutes at 375°, then top with fresh herbs.

Done.

For an even quicker meal, you can use a veggie mix like Cuciferous Crunch or Power to the Greens at TJ's.
.
.
.
.
.
.
#bshplease #bodysoulhome #holisiticnutrition #healthyfats #guthealth #pdxnutritionist #pdxnow #plantbased #alltheveggies #jerf #glutenfree #grainfree #dairyfree #nutritionist #makesmewhole #healthyeah #iamwellandgood #healthyfoodshare #mindbodygram #eatwellbewell #feedfeed #nutritionaltherapy #rootcause #bedeeplyrooted #easymeals #eatclean #quicklunch #healthylunch


1

Who loves a thick and creamy dressing?! 🙋🏾‍♀️

I’m lactose intolerant so I’m always looking for dairy free #healthyswaps. This new CREAMY DREAMY ALMOND DRESSING recipe that’s up on the blog today #linkinbio has the luscious deliciousness of buttermilk or sour cream minus the bloat 🤗 I know a bunch of you are vegan or dairy free, so this will definitely help curb your creamy cravings. Thanks to nut butter, you get that creaminess with the added bonus of all the healthy fats you’re looking for! It just wouldn’t be the same without nut butter! Check out the “DIY DRESSING” video in my Insta highlights to see the step by step of how to make this...be sure to watch to the end so you can see that SUPER creaminess.

P.S. I’m entering this recipe into @spreadthelove’s nut butter recipe contest! I’d love love love to win so I can eat full freebie jars of nut butter and jam (how good does marionbery jam sound?!) and they can “spread the love” about my blog! As a new blogger I’d be great get my recipes some more exposure on the interwebs. Plus it’s always great to help a small family business making all natural, from scratch products find some new hungry customers! Head over to their website, spreadthelovefoods.com to check out all the delicious options; their products are also on Amazon for all of you with Prime accounts🎉
.
.
.
.
.
.
.
#SpreadTheLoveAmbassador #nutbutter #almondbutter #saladdressing #eatmoresalad #saladideas #salad #turmeric #lemonrosemary #foodgawker #f52grams #thecookfeed #feedfeed #bhgfood #cookathome #foodbloggerpro #healthyandtasty #foodphotography #healthyfats #abmfoodie #buzzfeedfood @carlabiesinger


0

📸Artist: @barithedietitian
Partner: SleepWatch
Digital on IG
640px x 640px
.
.
.
Visit @truefluence to form the best partnerships on earth!
.
.
.
SC:BjZf3SgnYXX
postinfo.co/barithedietitian
Something I always try and chat with my clients about is the importance of sleep! A good nights sleep is so imperative for our body in so many ways. When we don’t get enough sleep (less than 6.5 hours), our body produces more cortisol, a stress hormone. In an effort to calm ourselves down, our body then produces extra serotonin. In order to do so, we need to convert tryptophan into serotonin (with the help of vitamin B6). Tryptophan can be found in chocolate - which may account for your chocolate/sugar cravings throughout the day! But tryptophan can also be found in oats, cheese, eggs and more! So, if you’re not getting enough sleep and feel like your eating a lot more junk food than normal, it may be your body’s attempt to produce more serotonin in order to relax. Just some food for thought 💭
.
.
I’ve been using the @sleepwatchapp app to track my sleeping patterns and cross reference them with my mood and food cravings! It’s pretty interesting to see how after a bad nights sleep, I’m more irritable and more likely to snack throughout the day - especially on foods containing sugar (Harribo strawberries, I’m talking about you 😏). Check out the link in my bio to learn more about the @sleepwatchapp ! #sleepwatchapp #sleeptracking #sleephealth #sponsored #ad .
.
.
.
.
#breakfast #avocado #avocadotoast #scrambledeggs #smokedsalmon #guthealth #plantbased #wholefoods #nutritioneducation #intuitiveeating #foodforthought #rdchat #dietitian #nutrition #nutritionist #wellness #healthnut #healthyfats #eatrealfood #foodfreedom #foodblogger #feedfeed #buzzfeedfood #huffposttaste


1

The Chocolate 🍫 plant based 🌱protein shake has been a fav 💕 this month for our C9 customers as they have been adding hot water turning it into a hot chocolate ☕️ #healthylifestyle #detox #cleanse #guthealth


1

These fat bombs are my new favorite! ❤️ I added flax seed, crushed walnuts and shredded coconut to mine and a little sugar free chocolate syrup! ☺️ .
.
.
.
.
#fatbombs #ketogains #ketocommunity #easyketo #lazyketo #sweetooth #healthyfats #cocnutoil #ketogirl #ketogainz #ketolife #ketones #ketofam #ketofood #lowcarbhighfat #lowcarblifestyle #mct #getthosemacros


0

Friday night and I'm feeling lazy AF. That means PIZZA PARTY. Anyone want to join?

I try to not buy too many packaged foods. They're more expensive and I like to control all of the ingredients I eat. With that said, I LOVE when there are brands that create products I can grab for a more nutritious version of favorites when all I want to do is indulge and not have to cook up a whole meal from scratch. This one here is one of my favorites for these times: - @cappellos naked grain free pizza crust
- @raoshomemade marinara - @applegate chicken sausage
- red onion
- kale
- mushrooms

You're welcome.
#mealprep #easymeals #healthymeals #healthyfats #eatclean #paleo #whole30 #glutenfree #summermealideas #kickcravings #hormonehealth #eattherainbow #eatyouveggies #fuelyourbody #foodismedicine #eatyourmedicine #functionalmedicine #nutritiontips #eeeeeats #huffposttaste #wellness #eatyourgreens #grainfree


0

💩💩it's the 22nd day of the month, there's 2 NUMBER "2"'s in 22, are you picking up what I'm putting down?? 💩😂#cacaday
Anyways, I made these RAW VEGAN & PALEO ALMOND JOY COOKIES sweetened with dates and you'll never know! My brother hates dates and he had no clue they were in there 🙊😏 here's the recipe!
__
___
______

cookies:
1 cup dates
1/2 cup almonds
1/2 cup coconut flakes
(blend all in a food processor until everything is sticky!) chocolate:
1/4 cup cacao powder
1/4 cup coconut oil (unrefined if you want it to taste more almond joyish!)
3 tbsp maple syrup
(whisk together!) Now make the cookie batter into cookie shapes, and dip in chocolate. then freeze to harden*** for about 10 minutes and then eat! Super quick and super easy! ***PLACE ON WAX PAPER TO PREVENT STICKING

_____
_________ 👇Comment below if you make 'em!👇 ~stay strong 💪😸 #recipe #healthyrecipe #almondjoycookies #rawvegan #raw #vegan #plantbased #healthy #paleo #grainfree #glutenfree #clean #dessert #snack #chocolatecovered #noaddedsugar #nobake #cacacookies #poopcookies #almond #soyfree #healthyfats #fatbombs #food #yummy #delicious #healthfood #groovythemes_fitness #staystrong


0

Break-fast 2pm
Hard boiled egg🍳
Bacon 🐖
Cheese 🧀
Cucumber 🌿
Cream cheese 🐄
Strawberries 🍓 (51 lbs down goodie)
#keto #lowcarb #lchf #intermittenfasting #Atkins #fatadapted #myweightlossjourney #foodie #follow #eathealthy #organic #breakfast #healthyfats #twomealsaday #ketoaf #ketoon


0

Guacamole today!
At least...my version of it!
I love to pot tomatoes in it and basil of course, my so far favorite herb.
Perfect side for meat, eggs, fish and almost everything; also good as pasta or rice sauce and flavor.
Go fit, go guacamole!

#myfitdiary


1

Peter Piper picked a peck of perfect pickles and put em’ in a pouch! - We don’t want to ruin the alliteration for you but it actually wasn’t Peter Piper at all. It was Van Holten’s. They’ve been perfecting pickles since 1898 and their portable pickles are so DILL-iciously DILL-ightfull even the proudest pickle purists will pucker with delight! - try saying that five times really fast!
🥒
find Van Holten's Pickles online at VanHoltenPickles.com
🥒
#keto #ketogenic #ketodiet #ketosis #ketofam #ketolife #ketosnack #healthyfood #healthylifestyle #healthymom #ketomom #ketofood #glutenfree #lchf #paleo #paleodiet #lowcarb #lowcarbdiet #lowcarblife #lowcarbhighfat #healthyfats #nuts #ketogeniclifestyle #ketogenicdiet #ketoweightloss #ketocommunity #ketogirl #pickles


2

I got this cauliflower thins to try and I am so excited, what should I make? Pizza, quesadilla .... umm! @outeraislegourmet


1

☝🏼WHY MACROS MATTER☝🏼

Last post I shared a glimpse of my life pre-Paleo. Adopting a Paleo lifestyle changed my life dramatically and bonus: it happened nearly seamlessly.

I believe this is partly due to my 95/5 approach to Paleo (and the mental sanity that provides) but more so due to the fact that I'm finally giving my body the nutrients it needs.

The way in which many people structure their meals is making it VERY HARD to stick to eating healthy (picture Food Pyramid recs🙅🏼‍♀️ which is now “Choose My Plate” by usda). MUCH MUCH MUCH harder than it needs be.

When grains are filling at least half your plate, you're handing yourself an energy roller coaster with insulin spikes that will keep you from burning excess fat. It also leaves very little room to prioritize calories from healthy fats. Meaning your body will suffer even further (on a nutrient and even neurological level). This framework is keeping people fat, sick, and full of cravings.

Pictured here: the Paleo plate. You may recognize this graphic from my Paleo Build-a-Meal Formula (click the Free Resources link in my profile to get a copy if you haven’t).

The carbs are cut way back compared to a SAD or whole grain plate and they’re limited to starchy veggies and tubers (much lower glycemic impact than grains). Healthy fat is prioritized, along with a large serving of non-starchy veggies, which are full of fiber to help fill you up and keep blood sugar even. This plate will help you burn fat, feel energized, and lessen your cravings.

Many people are structuring their plates in a way that is completely out of balance, which results in the body *not* getting the nutrients it needs to thrive. You know your macro balance is off if you:
• regularly feel intense cravings
• get hangry
• have a hard time knowing when to stop eating
•••
My switch to Paleo happened very gradually (read: years). But the full switch happened and *finally* stuck, when I committed to the breakdown above. My body thanks me on a regular basis by remaining full chill, no ups and down, just consistently happy with high-fat meals 😌

Q: Have you tried high-fat? If so, what benefits have you seen in your life?


1

Oh, hellooooooo! Look what's back! -
-
🥑🌶️🥑🌶️🥑🌶️🥑🌶️🥑🌶️


2

Shoutout to my girl Roxy for killing her results!!!!! So proud of you, zzamnnnn new hair and new body! #BodyGoals


2

Another quick and cheeky stir fry! 2 oven baked salmon fillets and stir fried noodles with fresh chillis, garlic, pepper and a pinch of sea salt.
#nomnom
#personaltrainer #makeitpersonal #knowyourgoals #food #foodie #asia #chef #fish #eat #healthyfats #salmon #noodles #spicy #lift #life


0

Do you have a serious sweet tooth? The reasons for craving sweets are many, & are often assuaged by eating desserts & sugary snacks. Blood sugar abnormalities such as reactive hypoglycemia, a deficiency in B vitamins, an overgrowth of yeast in the digestive tract, a deficiency of HCl &/or pancreatic enzymes & hidden food allergies are all causes of sugar cravings.
_
The more sugar you eat, the more you will crave it. Sugar is very addictive & hooks into the primeval need for something sweet. The cycle of sweets & sugar cravings is a merry-go-round we should all get off of (trust me, I was on it for decades 😩). It takes 3-4 days to clear the residue of sugar from the body & even longer to get rid of the craving.
_
Sugar increases our needs for B vitamins & vitamin C. The body has to rob its stores of B vitamins to handle the sugar. Sugar also places an unnecessary burden on the adrenal glands, which are essential for blood sugar control. The adrenals respond to sugar by releasing cortisol, which can lead to mineral deficiencies by causing the body to dump minerals.
_
If you have a sugar addiction & are interested in ways to kick this unhealthy habit, DM me & let’s chat about how Nutritional Therapy can help!
_
#livewell #eatwell #bewell #loveyourself #nutritionaltherapy #foodismedicine #nourishyourbody #healthyliving #holistichealth #healthyfood #healthyfats #healthymind #eatrealfood #enjoylife #neverstoplearning #mindfulness


1

I’m finally getting back into the swing of creating consistent blog posts and I’m sharing a really good one today! I promise more beauty content will be back next week but you guys keep asking for more food related content so here you go! Today I’ve shared 8 Easy Healthy Food Swaps aka ingredients to substitute for those with better nutritional value. Comment below how you liked this post and if you have any food swaps of your own. • Link in my bio• Have a fun weekend! #andreafontanabeauty


6

Chocolate Butter - my after dinner mint 🤤 Except it's after lunch and not minty 🤔 But I have a minty fat bomb recipe too 😉 They all exist in my bio link under the recipes tab 🤗
.
.
.
#chocolatebutter #darkchocolate #butter #keto #eatfat #eatfatlosefat #eatfatburnfat #ketotransformation #ketofood #ketorecipe #recipeoftheday #recipes #lowcarbhighfat #lowcarb #fatbombs #fatbombfriday #100poundsdown #healthyfats #healthylifestyle #health #instahealth #diet #instadiet


1

Pretty excited my @bulletproof order cake just in time for my next flight. I can’t wait to try the Collagen Bars. It’s not easy to get those in Canada! Thank you @vitaminshoppe for making those available here.
#bulletprooflifestyle #bulletproof #brainoctane #biohacking #biohacker #healthyliving #healthyfood #healthysupplements #activatedcharcoal #coconutactivatedcharcoal #healthysnacks #healthyfats


2

Enjoying lunch on this beautiful Friday 🌞 Taking this weekend to set some new goals for my diet and training. Pictured here is some tofu pepper and broccoli & added in some avocado. (This keto diet has not been easy in the slightest but I take it one day at a time)


2

Current situation!! 😁😋
.
Full of nutrients and flavor 🤗 Stop denying yourself balance, clarity, and better health... Meat is not your friend 😉
.
It's all mental... Ask yourself this, if meat is soo good, then why does it take hours to get the "seasoning" right?! Your average vegetables take less than 30 minutes to cook, and they are all already seasoned lol IJS and some of them you are already using to season that same meat 😂
.
Treat yourself, stop cheating on your health!! It's as hard as you make it...
.
Follow @happiefood for easy, and super tasty alkaline electric vegan recipes and ideas including this deliciously yummy and extra refreshing summer salad here!!
.
.
Stay blessed and stay woke my beautiful Kings and Queens,
💞 Happie Ree
.
.
#motivation #govegan #happiefood #foodpic #fearlessfriday #health #healthyfats #colorful #cleaneating #rawfood #alkaline #drsebi #diet #easy #recipes #healthyfood #foodblogger #fitness #yummy #lunch #dinner #salad #selfcare #vegan #vitamins #vegetarian #plantbased #fitfood #postworkout #energy


1

Recently a friend of mine asked me about cooking steak and I was reminded of a @ketovangelistkitchen episode where the wonderful @therealcarriebrown talked us through cooking the perfect steak. So I told them how to cook the perfect steak. I really is flippen awesome and super quick to do. I just finished cooking the steak and veggies for my wife, and it took less that 30 minutes. That got me thinking that others may have the same question, so I figured I could do a quick write up. *If you want the whole dissertation, the podcast episode I was referring to is episode 61 - steaks pt.2*

Preheat oven to 400.
Heat up an oiled skillet.
Once oil is steaming season you steak placing on skillet.
Flip steak every minute for about 5 minutes
Then place steak on an oven safe skillet/sheet and cook for another 5 minutes or so.
Less if rare, more if well done.
Carefully take pan out of oven, let rest for another 5 minutes
Enjoy you seriously good steak!

#eatmeat #eatrealfood #steak #eatsteak #steaktime #meatheals #carnivore #carnivorketo #zerocarbketo #healthyfood #healthyfats #healthfat #healthyfamily #keto #ketogenic #ketolife #ketolifestyle #nsng #lchf #lowcarb #lcpaleo #lowcarbpaleo #paleo #Banting #primal #fatisfuel #fatadapted #carnivoreketocut #thrivingonfat


1

I have kind of a love-hate relationship with radishes to be honest. I love their crunch and their zippy flavor but sometimes the bitterness gets to be too much. . . .
Despite my rocky relationship with them, I try to add them to my diet as much as possible because they are packed with nutrients (vitamin C and glucosinolates to name a few)! This week I got a bunch of english breakfast radishes from @dirtrichoregon and decided to make a garlic radish butter!
. . .
Healthy fats + spicy radish + whole grain baguette = one happy nutritionist. This simple recipe will be sent out to my mailing list tomorrow morning - sign up using the link in my bio if you want in!


6

Recently, I have been absolutely loving this foundation from @mineralfusionnaturalbrands 😊 I love that their products are EWG approved- meaning that they do not contain any harmful toxins! It took me a while to find a natural foundation that works as well as drugstore and high end foundations but I can now honestly say that I like this foundation even better than any other one I’ve owned from Sephora! (I’m not sponsored at all- I just really love this product 💁🏼‍♀️) #nontoxicmakeup #crueltyfreemakeup #naturalmakeuplook


3

OMG. Made it to Friday. Just. So as a little treat for making it this far... Raspberry and coconut slab! No refined sugar, gluten, dairy, nasties. Handmade chocolate too!


3

We live in a world of filling our bellies with a whole lot of processed food and carbs. It’s easy, tasty and cheap...so of course it can become a habit. As a mom, it would be super easy to always appease my kids with things that come from a bag. But I know, and you know, that this is not the way God made us to eat. He filled out earth with glorious plants, veggies, fruits, nuts and minerals that we should be consuming everyday. He put animals on this planet for them to roam freely and for us to hunt them and I believe eat them. Our bodies fall apart when we fill them with things made in a factory all day. I always tell my students that if they eat food in my classroom it has to come from the dirt or from a tree. When your plate is veggies first, and then meat and fiber filled carbs, then you will start to feel amazing and like how God intended your body to feel. I know that it’s not always this simple, but cut out the junk and fill your body with real food. .
.
.
.
.
#goodforyou #locallygrown #hangingfruit #frommybackyard #yesplease #everyday #healthyfats #goodforthebrain #clearskin #eatlocal #eatlocalgrown #backyardgarden #youarewhatyoueat #eatthis #eatlikeyouloveyourself #mentalclarity #preworkoutmeal #everymorning #healthybreakfast #mealprep #naturalmomma


1

Just a few pics of some of the stuff that I’m munching on during ketosis 😋. Of course, some eggs, cheese and charcuterie are also in my diet with lots of greens and non starchy veggies. There’s also that pic of all the grass fed fatty meats I’ve ordered 🥩🧀🍖🍗. I haven’t had blueberries yet, but they’re one of a very few fruits one should even think about eating. Fruits are nature’s candy. They’ll transition you out of keto if you’re not careful. Remember, test- but stick to berries, as they generally have less sugar per serving. Please understand, I am no expert in it. I have read and studied enough of it to understand the science behind it, but I am going through it for the first time (did it years ago with no meter) and documenting it for those of you that are interested. So far, excellent. The key is to record numbers on your ketometer to make sure you aren’t burning muscle because you aren’t fat adapted yet. That will happen too if you don’t consume enough fat. By the way, I was hungry this afternoon so I ate some Peking duck, fermented pickles, and two tbsp of that awesome coconut peanut better with the blue top 😋. I checked- still in keto ✌🏽👅. ______________________________ #ketosis #nutrition #nutritionscience #science #factsmatter #fat #healthyfats #antiinflammatory #inflammation #fightcancer #fightdisease #longevity #eattolive #happiness #gratitude #martialarts #fitness #exercise #fatloss #thankful #fitfam #workout #fasting #fightcancer #cancersucks


2

Summer is for salads! No cooking in the heat or prepping for an hour. I love me some quick easy salads. Lately we’ve been buying the salad kits which are basically just pre cut lettuce/cabbage/carrots & a dressing packet. To make them interesting I add any combination of cucumber/ tomatoes/bell pepper/avocado/meat/sunflower seeds/nuts/dried cranberries. Whatever I have on hand really.
#summertime #salads #mixitup #healthylifestlye #alltheveggies #healthyfats #easypeasy #happyhealthyoily #theoilymama


1

Down 5 lbs since last month!
Alright y’all, so losing weight after having a baby is a bitch. Honestly. I was always tired and super focused on taking care of my baby and completely ignoring my own health. I ate what was convenient, which was usually crap. Over the last few months I’ve cut out heavily processed foods, refined sugars, carbs, alcohol & I quit smoking. I finally started taking care of myself and focusing on my health! I have more energy, more focus, and significantly less anxiety.
40 lbs to go! ♥️
_____________________________________
_____________________________________
#keto #ketogenicdiet #fueledbyketones #bodybybacon #weightlossjourney #weightloss #lazyketo #ketofit #healthyfats


3

• B R .E A T. H E • .

It’s lunch time at the office again. We live in a world that moves so fast - It becomes easy to make “a quick lunch” just that. . another quick task to get through. An afterthought that leaves room for bad or unconscious choices when not planned well. It happens to all of us. After years, this is something I am just now calling into focus for myself. .

Even though I only take 30 minute lunches, I have been trying to bring mindfulness and peace to that time. A mid-day “reset” so to speak. Taking the time to prepare my lunch the night before and grabbing it in the morning has made such a difference. Knowing that’s one less thing I’ll have to figure out makes my day flow better. .

It’s so easy to say, “I’m so busy, I don’t have time”. I know... I’m the queen of that... but remember that eating well is a form of self respect. It’s time to take yourself off the back burner and do something for you. Choose one thing that could improve your day (it doesn’t have to be food related) and take just a minute longer to make it happen. You will feel the difference. ✌🏼 Have a great weekend y’all! 🖤
.

#selfcare #breathe #mindfuleating #eatwell #bewell #office #lunchbreak #protein #healthyfats #veggielove #brighteyedandbushytailed


2

A scramble and a breakfast sandwich to start the morning 🌟


3

These pictures of me over 40 years ago when I worked for the now defunct Control Data Corporation in my late 20’s. I weighed less than 100 lbs back then. Fast forward to my 60’s and becoming a type 2 diabetic, at my heaviest, I weighed 167. •
I’m 5’1” and a good weight for me is 115 to 120. I’ve lost 21 lbs over the last 1.5 years. It’s been slow progress so I’m doing even lower carb to zero carb as much as I can. That’s what seems to work best for me. I’m stepping it up because in a few months, I will be reuniting with some of the people I worked with all those years ago. I haven’t seen them, but recently had telephone conversations with a few of them. •
I want to look my best when we have our reunion in the fall. It remains to be seen as to how much weight I can drop in the next 4 months. My goal is to lose 25 lbs. I won’t look like that skinny 28 year old in those old pictures with that funky hair, but I will be 70 years old in August and just want to be a better version of me. •
#keto #ketofam #ketosis #healthyfats #healthyfood #healthylifestyle #lchf #lchfdiet #lowcarb #lowcarbdiet #lowcarbmeals #diabetes #dietaryfat #weightloss #weightlossgoals #weightlossjourney #weightlosstransformation #eatfatlosefat #eatclean


5

I should probably take pics of these in my hand because they’re not big but definitely piled high and packed with awesome. Mug muffin seasoned with ranch seasonings, buttered and toasted and topped with spicy guacamole, leftover roast beef, queso quesadilla, and a yolky egg. 🤤
.
.
.
#keto #ketogenic #ketogeniclife #lchf #healthyfats #almondflour #guac #lowcarb #sugarfree #grainfree #lowcarblifestyle #ketomom #leftovers


6

did you guys know that home popped popcorn is one of my FAVORITE snacks?! what're some of your favorite healthy go-to's?


4

RAW VEGAN CHOC CARAMEL SLICES


Guys! This is (from now on) my go to dessert/ filling snack because it is FULL of healthy fats, protein, and many other nutrients. Not only is it good for you, but it’s also so freakin DECADENT and DELICIOUS!


For the base:
~1 cup of any nut of choice(I used pecans)
~6 soaked dates
~sea salt


For the caramel filling:
~1 1/4 cup any nut of choice
~6 dates
~4 tbsp almond butter
~2 tbsp coconut oil
~4 tbsp maple syrup
~1/2 tsp sea salt
~tsp vanilla extract


For the choc layer:
~4 tbsp cacao powder ~4 tbsp maple syrup/ agave (or less if preferred)
~4 tbsp coconut oil (You can substitute this with full fat coconut milk, like I did) - Once the base has been blended, put in the fridge for 1 hour. Blend the caramel filling and spread on top of base with the choc layer on top. I recommend leaving this in the fridge for 4 or more hours to firm! #deliciousfood #plantbased #nutrientdense #veganteen #vegansofig #vegan #veganrecipes #veganism #veganislove #rawvegan #healthylifestyle #dessert #healthyfats #healthyfood #healthydessert


1

Do YOU take your fish 🐟 oil?
-
@coromega sent over some fish oil squeeze packets which are hella convenient and come in different flavors. Plus it’ll make you as swole as I am 💪🏾😉. Lol 😂 ok maybe not all that but def give em a look 💯
-
@coromega
@sbo_ceo
.
.
.
.
.
#fishoil #coromega #epa #dha #healthyfats #healthyfat #omega3 #powerliftinglife #swolepatrol #fishfriday #makinggains


0

after 4 weeks I lost 2 stone, didn't even realise just how big I was, so happy I decided to get into keto and intermittent fasting, gone a little over my carb allowances the last 2 days bit back at it tomorrow to make more changes and get the body I want... #keto #ketodiet #intermittentfasting #weightloss #fromfattofit #chubby #happy #transformation #healthy #diet #dieting #healthyfats #friday #weekend #happyfriday #beforeandafter


2

Fried boiled eggs on day #3 of this eggfast. Definitely a new favorite, this sauce is EVERYTHING!😋😍
#lchf #keto #ketocouple #macros #yumyumsauce #eggs #healthyfats
#lowcarb #eggfast #sugarfree #glutenfree #weightloss #getcreative


0

Real ingredients are KĒ. Get to know what makes our high-fat, low-sugar Chocolate Chip FatFor keto bars so delicious. Join our waitlist (link in bio ☝️).⠀⠀⠀⠀⠀⠀⠀⠀⠀
.⠀⠀⠀⠀⠀⠀⠀⠀⠀
.⠀⠀⠀⠀⠀⠀⠀⠀⠀
.⠀⠀⠀⠀⠀⠀⠀⠀⠀
.⠀⠀⠀⠀⠀⠀⠀⠀⠀
.⠀⠀⠀⠀⠀⠀⠀⠀⠀
.⠀⠀⠀⠀⠀⠀⠀⠀⠀
.⠀⠀⠀⠀⠀⠀⠀⠀⠀
.⠀⠀⠀⠀⠀⠀⠀⠀⠀
#kelife #kefuels #keto #ketodiet #ketodietlifestyle #ketodieter #ketodieting #lowcarb #lowcarbliving #health #healthyfood #realfood #eathealthy #lchf #lowcarbdiet #ketofriendly #healthyfats #ketosis #ketolife #ketogenic #ketogenicdiet #ketolifestyle #ketofam #ketosnacks #ketosnack #ketogenicliving #ketolifestyle #ketofood #lowcarbhighfat


1

Breafast for lunch! Veggie fact: Chives have great detoxing qualities! They have antioxidants and fiber to get toxins out of the body.


2

Raspberry salad, looks unassuming, tastes blooming gr8 🥗


1

Today's lunch was a super yummy S meal...scrambled eggs with cottage cheese and Oaxaca cheese whipped in...the flavor was amazing! I also had zucchini and yellow squash with it. The cottage cheese gave it an extra protein boost and made it a hearty and filling meal! Yum!

#trimhealthylifestyle #trimhealthyveteran #thm #smeal #healthyfats #healingmybrain #trimhealthymama #thmforlife #rsdwarrior


0

a little bit of a late one this evening! Steak taco refuel meal after a quick C1: workout 2 and a 5min abs burner at the end! .
.
#90dayplan #90daysss #cycle1 #90daycycle1 #thebodycoach #joewicks #sssplan #sssplancycle1 #cycleone #ssscycleone #joewicks #leanin15 #healthyeating #healthyfats #healthyfood #HIIT


2

Lunch! Butter lettuce & organic baby spinach, tomatoes, criminis, sunflower seeds, jalapeños, avo, lemon garlic vinaigrette.


6

Don’t fear fats!
But avoid the processed junky trans fats, and choose healthy fats from “whole foods”, they are our friends, they make us feel good, keep our thinking sharp, protect our organs, help absorb fat soluble vitamins A, D, E and K, increase the feeling of fullness and is essential for creating and maintaining healthy cell membranes and hormones! Eat smart!!! Simple lunch contains protein, healthy fats and carb: soft boiled egg, 🥑, smoked salmon ricotta cheese on a whole grain toast, arugula + grape tomatoes salad (not pictured: balsamic vinegar and olive oil for dressing). #HappyFriday beautiful peeps 💕! #forksoverknives #eatrealfood #paleo #wellnessjourney #macros #fitnessfood #fitnessmom #fitnesstips #eatTogetAbs #eattogetfit #eattogetlean #keto
#healthyeating #happyfriyay #eatforabs #foodismedicine #paleoish #eatgoodfeelgood #cleanfoodshare #mealprepping #mealprepmondays #healthyfoodshare #fridaymotivation #mealprepsunday #healthyfats


5

Breakfast: 1/3 c egg white omelettw w 1/4 avo. , tomato & arugula #avocado #healthyfats #glutenfree #antiinflammatory #pcos


0

Simple snack, almond butter & apple & berries w apple tea #glutenfreelife #healthysnack #healthyfats #pcosdiet


0